DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33964 and CG2906

DIOPT Version :9

Sequence 1:NP_001033941.1 Gene:CG33964 / 3772719 FlyBaseID:FBgn0053964 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001097225.1 Gene:CG2906 / 35753 FlyBaseID:FBgn0033240 Length:456 Species:Drosophila melanogaster


Alignment Length:526 Identity:119/526 - (22%)
Similarity:209/526 - (39%) Gaps:121/526 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QLQRRLDGLLAFLNPHWDFVNCHMVNYLTDQHWDGFLSETLKSEIAG---KEDVALAIEDL--FW 67
            :|:|.|:.|..:   .| .::.:::::..|.||         |::.|   |...::.:|:|  ..
  Fly     7 KLERGLELLKKY---EW-LLDAYVLDFFIDDHW---------SKLPGNWQKHLESIPLENLGDLL 58

  Fly    68 KTDESERFPAW-------REFLGKSKQERLSLHPKLLTSVEELIEGQGNSTQLSIREF------- 118
            |.:.......|       :|.|.|....|:..||            ..||...|:.:.       
  Fly    59 KNENHNTQLTWPLDLKNLQEELRKLCVSRVPKHP------------PDNSLPCSLLDHPKLKYVF 111

  Fly   119 ---MSAKKCHEVDLTAVLVDQLVKNSGQDCFIVDAGDGKGYLSSRLALQYGHRVLGIDANAANTE 180
               :..||.||:...|.:.....:.:..| ||||.|.|.|:|:..|...||.||...:       
  Fly   112 LKRVKPKKHHEIIRMAEICALSQQKTPVD-FIVDFGAGVGHLARVLGYGYGLRVCCYE------- 168

  Fly   181 NALNRNRKLQRAWNGLTERAELQVQGITPKRRSKKSPA------------RESTKSAPALENYKT 233
                    :|...|......:|:::.:..|..|:....            ..|||....|.:.:.
  Fly   169 --------MQPDLNQQAREIDLKLESMAAKHLSEDETTHFQRPVHLTHRLESSTKPEQFLSSIRQ 225

  Fly   234 TAKFITTELNFGALLAENFTQFRPEDSPNICLTGLHTCGNLAATCLQVFHAQTDCRLLCNVGCCY 298
            ..:.......||.:                   |||.||||..|.:::|......:.|..|||||
  Fly   226 ALQLTDDNFRFGVI-------------------GLHPCGNLGPTLMRMFLGCPQAKFLNFVGCCY 271

  Fly   299 HLLRERYSQQEFFGNKSLMELQTDYGFPLSQYLRER-QVRMGRNARMLAAQSIE------RTLDT 356
            ..:.          .:|....:..:|:|||..|::: :.::...||.::..::|      |..|.
  Fly   272 QKMT----------TQSTHPREHVHGYPLSSELKDKNECQLSYEAREISCHAMEVYHDRLRMGDY 326

  Fly   357 KELPNVTLYYRALLEILVCRHAPELKN-ELQVGKVRKFESFEEYIQKC--ATKLDAPWLAAVEKE 418
            :.|...:|  ||..|.::....|||:: .|:..|.....:|.:|.||.  .|:.:|.....:..:
  Fly   327 QHLRIHSL--RAAAERIIVHQFPELRHCALRNVKYSPGMTFHQYFQKAVQGTRFEALDSRTLSNQ 389

  Fly   419 ELQSLLQEYAVHKYFLDLFYLLRMSFAPVLESLILLDRLLYLKELGYERSYLIDLFDPVISPRHF 483
            :.::.|..:    ..:..||.||:..||::||:||.||.|:|.|...: ..:..:|||.:|||:.
  Fly   390 QTETDLANW----QRIVSFYTLRLMMAPLVESIILYDRCLFLMENDCQ-VQIEAIFDPRLSPRNH 449

  Fly   484 AIVSIK 489
            ...::|
  Fly   450 ITRAVK 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33964NP_001033941.1 Methyltransf_32 122..304 CDD:290402 45/193 (23%)
CG2906NP_001097225.1 Methyltransf_32 118..277 CDD:290402 45/203 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2651
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12496
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5160
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.