DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33964 and ORC3

DIOPT Version :9

Sequence 1:NP_001033941.1 Gene:CG33964 / 3772719 FlyBaseID:FBgn0053964 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_862820.1 Gene:ORC3 / 23595 HGNCID:8489 Length:712 Species:Homo sapiens


Alignment Length:437 Identity:99/437 - (22%)
Similarity:173/437 - (39%) Gaps:88/437 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 KEDVALAIEDLFWK-----TDESERFPA----WREFLGKSKQERL--SLHPKLLTSVEELIEGQG 108
            |..::|.|||.|.|     .|...||..    |::.  ||:.|||  .|:..|..::.|.::...
Human    19 KRKISLPIEDYFNKGKNEPEDSKLRFETYQLIWQQM--KSENERLQEELNKNLFDNLIEFLQKSH 81

  Fly   109 NSTQLSIREFMSAKKCHEV--------------DLTAVLVDQLVKNS---------GQDCFIVDA 150
            :..|.:.|:.....|..|:              |||...:.:.::|:         .:||     
Human    82 SGFQKNSRDLGGQIKLREIPTAALVLGVNVTDHDLTFGSLTEALQNNVTPYVVSLQAKDC----- 141

  Fly   151 GDGKGYLSSRLALQYGHRVLG--IDANAANTENALNRNRKLQRAWNGLTERAELQVQGITPKRRS 213
            .|.|.:|...::     :::.  :|..:...|:.....||...:.:.|:.......|...||..|
Human   142 PDMKHFLQKLIS-----QLMDCCVDIKSKEEESVHVTQRKTHYSMDSLSSWYMTVTQKTDPKMLS 201

  Fly   214 KKSPARESTKSAPALENYKTTAKFITTEL-NFGALLAENFTQFRPEDSPNICLTGLHTCGNLAAT 277
            ||.......:|.|.:...|....|.|..| :|..:.:::..:|     |.|.:.|:.|...:...
Human   202 KKRTTSSQWQSPPVVVILKDMESFATKVLQDFIIISSQHLHEF-----PLILIFGIATSPIIIHR 261

  Fly   278 CLQVFHAQTDCRLLC-----NVGCCYHLLRERYSQQEFFGNKSLMELQTDYGFPLSQYLRERQVR 337
            .|.  ||.:.  |||     ::.|..||....        :|.|:..|    ||..  :.|:.::
Human   262 LLP--HAVSS--LLCIELFQSLSCKEHLTTVL--------DKLLLTTQ----FPFK--INEKVLQ 308

  Fly   338 MGRNARMLAAQSIERTLDTKELPNVTLYYRALLEILVCRHAPELKNEL------QVGKVRKFESF 396
            :..|..:....|::..:...:|..:..:|...|.:|.| :.||.|..:      |...:|:..||
Human   309 VLTNIFLYHDFSVQNFIKGLQLSLLEHFYSQPLSVLCC-NLPEAKRRINFLSNNQCENIRRLPSF 372

  Fly   397 EEYIQKCATKLDAPWLAAVE--KEELQSLLQEYAVHKYFLDLFYLLR 441
            ..|::|.|::.....|....  |||.|.||:.  :|.|.::.|.:||
Human   373 RRYVEKQASEKQVALLTNERYLKEETQLLLEN--LHVYHMNYFLVLR 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33964NP_001033941.1 Methyltransf_32 122..304 CDD:290402 43/212 (20%)
ORC3NP_862820.1 ORC3_N 18..344 CDD:399784 75/359 (21%)
ORC_WH_C 597..709 CDD:407969
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.