DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33825 and HMGA

DIOPT Version :9

Sequence 1:NP_001027319.1 Gene:His1:CG33825 / 3772715 FlyBaseID:FBgn0053825 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_172943.1 Gene:HMGA / 838055 AraportID:AT1G14900 Length:204 Species:Arabidopsis thaliana


Alignment Length:211 Identity:46/211 - (21%)
Similarity:76/211 - (36%) Gaps:30/211 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GSAGTKAKKASATPSHPPTQQMVDASIKNLKERGGSSLLAIKKYITATYKCDAQKLAP----FIK 91
            |||.........:.|.||..||:..:|::|.::.|.:...|.|:|.:|    .|.|.|    .:.
plant     8 GSASDTHSSELPSFSLPPYPQMIMEAIESLNDKNGCNKTTIAKHIEST----QQTLPPSHMTLLS 68

  Fly    92 KYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKD-PKAKSKVLSAEKKVQSKKVASKKIGVSSK 155
            .:|......|:||..|..          ..|.:.| |..:.:....::|.|::..|:....|:  
plant    69 YHLNQMKKTGQLIMVKNN----------YMKPDPDAPPKRGRGRPPKQKTQAESDAAAAAVVA-- 121

  Fly   156 KTAVGAADKKPKAKKAVATKKTAENKKTEKAKAKDAKKTGIIKSKPAATKAKVTAAKPKAVV--- 217
              |...:...|:::......|.......||......:..|....:|......|.|.:|.|..   
plant   122 --ATVVSTDPPRSRGRPPKPKDPSEPPQEKVITGSGRPRGRPPKRPRTDSETVAAPEPAAQATGE 184

  Fly   218 ----AKASKAKPAVSA 229
                .:..|.||.|.|
plant   185 RRGRGRPPKVKPTVVA 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33825NP_001027319.1 Linker_histone 46..118 CDD:278939 19/75 (25%)
HMGANP_172943.1 H15 22..85 CDD:197772 19/66 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.