DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33825 and AT1G06760

DIOPT Version :10

Sequence 1:NP_001027319.1 Gene:His1:CG33825 / 3772715 FlyBaseID:FBgn0053825 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_172161.1 Gene:AT1G06760 / 837187 AraportID:AT1G06760 Length:274 Species:Arabidopsis thaliana


Alignment Length:148 Identity:28/148 - (18%)
Similarity:66/148 - (44%) Gaps:32/148 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   372 RTSLIVTIGPS------PRHRGETTSTILFGQRAMKVENMLKIKEE---FDYKSLSKKLEVQLDK 427
            :.:.::..||.      |:.|.:.....|   |..::...|:.|:.   :|:.: .||.:..|:|
plant    74 KMACVIYYGPDGELKTWPKEREKVEDIAL---RYSQLNEALRRKKSVTLYDFLN-KKKDKTNLEK 134

  Fly   428 --VIAENE---------RQLKA------FDDDVERINRQAQNRISEVEK--NFAEALEKEKLKCQ 473
              :|.:|:         ..||:      |:|.:.::.:..:..:|:|::  .|.|:.:.::.|..
plant   135 KAMITDNDDLKTCLKNVNVLKSPIADHYFNDQISQLIQSLEPHVSKVQERIRFVESQKHKETKLD 199

  Fly   474 MEYMESVKKLEEKLISNQ 491
            .:.:.|:..|.:.|..:|
plant   200 HQSLASIYSLNQSLNPSQ 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33825NP_001027319.1 H15 43..130 CDD:238028
AT1G06760NP_172161.1 H15 60..124 CDD:197772 9/52 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.