DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33825 and Rbm43

DIOPT Version :9

Sequence 1:NP_001027319.1 Gene:His1:CG33825 / 3772715 FlyBaseID:FBgn0053825 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001342537.1 Gene:Rbm43 / 71684 MGIID:1918934 Length:441 Species:Mus musculus


Alignment Length:132 Identity:29/132 - (21%)
Similarity:52/132 - (39%) Gaps:10/132 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VEKKVVQKKASGSAGT--KAKKAS----ATPSHPPTQQMVDASIKNLKERGGSSLLAIKKYITAT 78
            ||:.:...|:.|.|..  |.||.:    ....|||..: ...::.:..|:..:.::||.......
Mouse   141 VEEVIYPSKSKGVAYIIFKEKKVAQDFIRQKKHPPGSE-PRLTVSHFSEKVFNYVMAILDLSVFR 204

  Fly    79 YKCDAQKLAPFIKKYLKSAVVNGKLIQTKGK-GASGSFKLSASAKKEKDPKAKSKVLSAEKKVQS 142
            .:.:.:.|...:||  |...:|...:...|| ...|||......|:....||.|.:.:..|....
Mouse   205 TQIELESLVVDLKK--KIPTLNFSPLGPSGKISVQGSFLAIMKLKQALISKAISPLENNRKDAGE 267

  Fly   143 KK 144
            ::
Mouse   268 RR 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33825NP_001027319.1 Linker_histone 46..118 CDD:278939 16/72 (22%)
Rbm43NP_001342537.1 RRM_SF 113..173 CDD:327398 8/31 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.