DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33825 and H1f7

DIOPT Version :9

Sequence 1:NP_001027319.1 Gene:His1:CG33825 / 3772715 FlyBaseID:FBgn0053825 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001019527.1 Gene:H1f7 / 500928 RGDID:1560024 Length:418 Species:Rattus norvegicus


Alignment Length:242 Identity:44/242 - (18%)
Similarity:105/242 - (43%) Gaps:37/242 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 QQMVDASIKNLKERGGSSLLAIKKYITATYKCDAQKLAPFIKKYLKSA--VVNGK---------- 102
            ||.|:.:::....||..|:|.:.:.:........:.....:||.|.:|  .|..|          
  Rat    21 QQPVERALRTPVRRGAQSVLRVSQLLLRAIAGHQRLTLAALKKELGNAGYEVRRKISSHQAGDST 85

  Fly   103 ------LIQTKGKGASGSFKL-SASAKKEKDPKAK---------SKVLSAEK--KVQSKKVASKK 149
                  |::..|..|:|.|:: ..|..:.|.|:::         ..||.:.:  :.:|::.|:||
  Rat    86 RSEKYTLLRVSGSDAAGYFRVWKISKPRRKAPRSRLTLGSHSHGKTVLKSPRPLRPRSRRKAAKK 150

  Fly   150 IGV--SSKKTAVGAADKKPKAKKAVATKKTAENKKTEKAKAKDAKKTGIIKSKPAATKAKVTAAK 212
            ...  ..|..|:.|..::.::......:..|.::.:.:|::: |:.....:::..|.....:.|:
  Rat   151 AREVWRRKARALKARSRRARSLARSMVRSRASSRASSRARSR-ARSRARSRARSRARSRASSRAR 214

  Fly   213 PKAVVAKASKAKPAVSAKPKKTVK---KASVSATAKKPKAKTTAAKK 256
            ..|..:..|.|:.:|.:..:.:.:   ::|:.:.|:. :|:|.|..:
  Rat   215 SSARSSARSSARSSVRSSVRSSARSSARSSIRSRARS-RARTRARSR 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33825NP_001027319.1 Linker_histone 46..118 CDD:278939 18/86 (21%)
H1f7NP_001019527.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..273 25/149 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 344..418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.