DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33825 and H1-5

DIOPT Version :9

Sequence 1:NP_001027319.1 Gene:His1:CG33825 / 3772715 FlyBaseID:FBgn0053825 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_005313.1 Gene:H1-5 / 3009 HGNCID:4719 Length:226 Species:Homo sapiens


Alignment Length:267 Identity:109/267 - (40%)
Similarity:134/267 - (50%) Gaps:53/267 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVVQKKAS-GSAGTKAKKASATPSHPPTQQMVDASIKNLKERG 64
            ||::|.|.:|:     ||.|||...:|||: .:||..|.|..||  .||..:::..::...|||.
Human     1 MSETAPAETAT-----PAPVEKSPAKKKATKKAAGAGAAKRKAT--GPPVSELITKAVAASKERN 58

  Fly    65 GSSLLAIKKYITA-TYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPK 128
            |.||.|:||.:.| .|  |.:|....||..|||.|..|.|:||||.||||||||:   ||....:
Human    59 GLSLAALKKALAAGGY--DVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLN---KKAASGE 118

  Fly   129 AKSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEKAKAKDAKK 193
            ||.|              :||.|.:..|...||..|  |||||...||..  |||.| |||....
Human   119 AKPK--------------AKKAGAAKAKKPAGATPK--KAKKAAGAKKAV--KKTPK-KAKKPAA 164

  Fly   194 TGIIKSKPAATKAKVTA---------AKPKAVVAKASKAKPAVSAKPKKTVKKASVSATAKKPKA 249
            .|:.|...:..|||..|         ||||||..||:|.|   :||||        :|..|..||
Human   165 AGVKKVAKSPKKAKAAAKPKKATKSPAKPKAVKPKAAKPK---AAKPK--------AAKPKAAKA 218

  Fly   250 KTTAAKK 256
            |..||||
Human   219 KKAAAKK 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33825NP_001027319.1 Linker_histone 46..118 CDD:278939 34/72 (47%)
H1-5NP_005313.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 21/49 (43%)
H15 39..117 CDD:238028 38/84 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 98..226 67/161 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10654
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4734
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2142
SonicParanoid 1 1.000 - - X117
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.990

Return to query results.
Submit another query.