DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33825 and his-24

DIOPT Version :9

Sequence 1:NP_001027319.1 Gene:His1:CG33825 / 3772715 FlyBaseID:FBgn0053825 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_510410.1 Gene:his-24 / 181545 WormBaseID:WBGene00001898 Length:208 Species:Caenorhabditis elegans


Alignment Length:253 Identity:92/253 - (36%)
Similarity:121/253 - (47%) Gaps:49/253 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVVQKKASGSA-GTKAKKASATPSHPPTQQMVDASIKNLKERG 64
            ||||||..:|         ||.||.:.||:.:| .||..||.|..:|||...|:..:||.||:|.
 Worm     1 MSDSAVVAAA---------VEPKVPKAKAAKAAKPTKVAKAKAPVAHPPYINMIKEAIKQLKDRK 56

  Fly    65 GSSLLAIKKYITATYKC--DAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDP 127
            |:|..||.|:|:..||.  :..::...:::.||..|.:..|:|..|.||:|.|::...|...|.|
 Worm    57 GASKQAILKFISQNYKLGDNVIQINAHLRQALKRGVTSKALVQAAGSGANGRFRVPEKAAAAKKP 121

  Fly   128 KAKSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEKAKAKDAK 192
            .|..|..:|:|...:||...:|            ..|||.|.|   .||.|...|..| |||..|
 Worm   122 AAAKKPAAAKKPAAAKKATGEK------------KAKKPAAAK---PKKAATGDKKVK-KAKSPK 170

  Fly   193 KTGIIKSKPAATKAKVTAAKPKAVVAKASKAKPAVSAKPKKTVKKASVSATAKKPKAK 250
            |.    :||||.|           |||:    ||..|.|||..|.|:..|.  ||.||
 Worm   171 KV----AKPAAKK-----------VAKS----PAKKAAPKKIAKPAAKKAA--KPAAK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33825NP_001027319.1 Linker_histone 46..118 CDD:278939 27/73 (37%)
his-24NP_510410.1 Linker_histone 38..112 CDD:366156 27/73 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 65 1.000 Domainoid score I6615
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I3461
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55300
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 1 1.000 - - mtm4774
orthoMCL 1 0.900 - - OOG6_110754
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.