DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33825 and LOC101734931

DIOPT Version :9

Sequence 1:NP_001027319.1 Gene:His1:CG33825 / 3772715 FlyBaseID:FBgn0053825 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_004915672.1 Gene:LOC101734931 / 101734931 -ID:- Length:220 Species:Xenopus tropicalis


Alignment Length:235 Identity:97/235 - (41%)
Similarity:124/235 - (52%) Gaps:27/235 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPA-TVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERG 64
            |:::|..|:.:|   ||| ..:||..|.|.:.:.|.||||    ||.|...:::..::...|||.
 Frog     1 MAETAAETAPAP---PPAEAAKKKKKQPKKAAAGGAKAKK----PSGPSAAELIVKAVSASKERS 58

  Fly    65 GSSLLAIKKYITA-TYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPK 128
            |.||.|:||.:.| .|  |.::....:|..||:.|..|.|.|.||.||||||||:....:.|:..
 Frog    59 GVSLAALKKALAAGGY--DVERNNSRLKLALKALVTKGTLTQVKGSGASGSFKLNKKPLESKEKA 121

  Fly   129 AKSKVLSAEKKVQSKKVASKKIGVSSKK-TAVGAADKKPK-----AKKAVATK--KTAENKKTEK 185
            ||.|  .|..|.:....|:||...|.|| ..|.||.|.||     ||.|.:.|  |.|:.||..|
 Frog   122 AKKK--PAAPKAKKPAAAAKKAPKSPKKPKKVSAAAKSPKKVKKPAKAAKSPKKPKAAKPKKVAK 184

  Fly   186 AKAKDAKKTGIIKSKPAATKAKVTAAKPKAVVAKASKAKP 225
            :.||.|.|....||  .|.|||  ||||||  |||.||.|
 Frog   185 SPAKKAAKPKAAKS--PAKKAK--AAKPKA--AKAKKAAP 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33825NP_001027319.1 Linker_histone 46..118 CDD:278939 29/72 (40%)
LOC101734931XP_004915672.1 Linker_histone 41..111 CDD:366156 29/71 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11018
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 107 1.000 Inparanoid score I4781
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X117
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.