DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33825 and LOC100498492

DIOPT Version :9

Sequence 1:NP_001027319.1 Gene:His1:CG33825 / 3772715 FlyBaseID:FBgn0053825 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_017950601.1 Gene:LOC100498492 / 100498492 -ID:- Length:204 Species:Xenopus tropicalis


Alignment Length:214 Identity:83/214 - (38%)
Similarity:110/214 - (51%) Gaps:13/214 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGG 65
            |:::|..|..:|   |||...||..|.|.:.:.|.||||    ||.|...:::..::...|||.|
 Frog     1 MAETAAETVPAP---PPAEAAKKKKQPKKAAAGGAKAKK----PSGPSAAELIVKAVSASKERSG 58

  Fly    66 SSLLAIKKYITA-TYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKA 129
            .||.|:||.:.| .|  |.::....:|..||:.|..|.|.|.||.||||||||:....:.|:..|
 Frog    59 VSLAALKKALAAGGY--DVERNNSRLKLALKALVTKGTLTQVKGSGASGSFKLNKKPLESKEKAA 121

  Fly   130 KSKVLSAEKKVQSKKVASKKIGVSSKK-TAVGAADKKPKAKKAVATKKTAENKKTEKAKAKDAKK 193
            |.|  .|..|.:....|:||...|.|| ..|.||.|.||..||...:|.|::...:.||.|.||.
 Frog   122 KKK--PAAPKAKKPAAAAKKAPKSPKKPKKVSAAAKSPKKPKAAKPRKVAKSPAKKAAKPKAAKS 184

  Fly   194 TGIIKSKPAATKAKVTAAK 212
            .....:||.|.|||..|.|
 Frog   185 PAKKPTKPKAAKAKKAAPK 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33825NP_001027319.1 Linker_histone 46..118 CDD:278939 29/72 (40%)
LOC100498492XP_017950601.1 Linker_histone 40..110 CDD:366156 29/71 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.