DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33846 and H1f4

DIOPT Version :9

Sequence 1:NP_001027354.1 Gene:His1:CG33846 / 3772702 FlyBaseID:FBgn0053846 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_056602.1 Gene:H1f4 / 50709 MGIID:1931527 Length:219 Species:Mus musculus


Alignment Length:261 Identity:103/261 - (39%)
Similarity:128/261 - (49%) Gaps:48/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGG 65
            ||::|.|..|:     ||..||..|:|||..:||...:|.|.    ||..:::..::...|||.|
Mouse     1 MSETAPAAPAA-----PAPAEKTPVKKKARKAAGGAKRKTSG----PPVSELITKAVAASKERSG 56

  Fly    66 SSLLAIKKYITAT-YKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKA 129
            .||.|:||.:.|. |  |.:|....||..|||.|..|.|:||||.||||||||:   ||....:|
Mouse    57 VSLAALKKALAAAGY--DVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLN---KKAASGEA 116

  Fly   130 KSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEKAKAKDAKKT 194
            |.|              :|:.|.:..|...||| ||||.....||.|.:..|..:|||       
Mouse   117 KPK--------------AKRAGAAKAKKPAGAA-KKPKKAAGTATAKKSTKKTPKKAK------- 159

  Fly   195 GIIKSKPAATKAKVTAAKPKAVVAKASKAKPAVSAKPK-KTVKKASVSATAKKPKA---KTTAAK 255
                 ||||......|..||.  |||:|||.|..:..| ||||..:......||||   |.||||
Mouse   160 -----KPAAAAGAKKAKSPKK--AKATKAKKAPKSPAKAKTVKPKAAKPKTSKPKAAKPKKTAAK 217

  Fly   256 K 256
            |
Mouse   218 K 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33846NP_001027354.1 Linker_histone 46..118 CDD:278939 34/72 (47%)
H1f4NP_056602.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 19/48 (40%)
Linker_histone 38..108 CDD:278939 34/71 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..219 64/159 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10384
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I4685
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2142
SonicParanoid 1 1.000 - - X117
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.990

Return to query results.
Submit another query.