DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33846 and H1f0

DIOPT Version :9

Sequence 1:NP_001027354.1 Gene:His1:CG33846 / 3772702 FlyBaseID:FBgn0053846 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_032223.2 Gene:H1f0 / 14958 MGIID:95893 Length:194 Species:Mus musculus


Alignment Length:252 Identity:88/252 - (34%)
Similarity:114/252 - (45%) Gaps:71/252 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGGSSLLAIK 72
            ::::|.|.|                  .:||.:..:..||....|:.|:|:..|.|.|||..:|:
Mouse     5 STSAPAAKP------------------KRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQ 51

  Fly    73 KYITATYK----CDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKAKSKV 133
            |||.:.||    .|:|     ||..:|..|..|.|.||||.||||||:|:    |..:||.....
Mouse    52 KYIKSHYKVGENADSQ-----IKLSIKRLVTTGVLKQTKGVGASGSFRLA----KGDEPKRSVAF 107

  Fly   134 LSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEKAKAKDAKKTGIIK 198
            ...:|:|  ||||:.|.....||.|..|..|||||                 ...|.|||     
Mouse   108 KKTKKEV--KKVATPKKAAKPKKAASKAPSKKPKA-----------------TPVKKAKK----- 148

  Fly   199 SKPAATKAKVTAAKPKAVVAKASKAKPAVSAKPKKTVKKASVSATAKKPKAKTTAAK 255
             |||||..|  |.|||.|     |.||..::||||        |...|||||::|.:
Mouse   149 -KPAATPKK--AKKPKVV-----KVKPVKASKPKK--------AKTVKPKAKSSAKR 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33846NP_001027354.1 Linker_histone 46..118 CDD:278939 34/75 (45%)
H1f0NP_032223.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28 7/40 (18%)
Linker_histone 25..96 CDD:278939 34/75 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..194 56/148 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2142
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.