DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wmd and CG7568

DIOPT Version :9

Sequence 1:NP_001097436.1 Gene:wmd / 37727 FlyBaseID:FBgn0034876 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001263071.1 Gene:CG7568 / 43482 FlyBaseID:FBgn0039673 Length:482 Species:Drosophila melanogaster


Alignment Length:314 Identity:71/314 - (22%)
Similarity:138/314 - (43%) Gaps:53/314 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QIPLTCSGHTRPVVHLDFSDICDAGYFLISACKDGSPMLRHGDTGDWVGTFEGHKGAVWNATLNR 72
            |:....|||...|..:.|    :..::|:        .|:.|.:|:.:.||    ..:::..:  
  Fly   151 QVEHILSGHDNVVFSVGF----NFPHWLV--------YLQSGGSGNNLTTF----SIIFSDKI-- 197

  Fly    73 NATLAASGAADFTGKVWNAVTGAEIHSFQHKHIVKSVAFD---RDSENIVTGSNEKLVRVFNLEQ 134
                 .:|:.|.|.|||:|.:|..:.:| :.|..:.||.:   .|.::|.|.|.:...|::::|.
  Fly   198 -----VTGSFDGTAKVWSATSGQSLCTF-YGHTAELVAAEFHPVDGKSIATASLDGSARIYDVET 256

  Fly   135 PEAQPEEYAGHTGAIKRALFCRGDKCIISAAEDKTVRLWDRMTGIEVQRLQFNSNPNSLEISSDN 199
            .. :.::...|...:..|.|.|..:.:::.:.|.:..:||    :..:.|......:|.|:|  |
  Fly   257 SH-ELQQLTHHGAEVIAARFNRDGQMLLTGSFDHSAAIWD----VRSKSLGHQLRGHSAELS--N 314

  Fly   200 HILTISHGSSISFWEIDTLKKLKEV-KVPTNVASASLHPDKHVFV-----------CGGE-DFKM 251
            .:...| ||.|:...:|...::.:. |:...:..|:.|.|:.:.|           |..: ..::
  Fly   315 CVWNFS-GSLIATGSLDNTARIWDTRKLDQELYLAARHSDEVLDVSFDAAGQLLATCSSDCTARV 378

  Fly   252 YKFDYITGNEIESFK---GHFGPVHSVKFSPDGELYASGSEDGTLRLWQTTVGK 302
            ::.:  ..:|:|...   ||...|..|.|||.|.:..:.|.|.|.|||.|..|:
  Fly   379 WRLE--GSSELEMLSLMAGHSDEVSKVCFSPSGCMLLTASADNTARLWLTESGQ 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wmdNP_001097436.1 WD40 12..297 CDD:238121 67/303 (22%)
WD40 repeat 25..60 CDD:293791 7/34 (21%)
WD40 repeat 66..101 CDD:293791 8/34 (24%)
WD40 repeat 108..144 CDD:293791 8/38 (21%)
WD40 repeat 150..186 CDD:293791 7/35 (20%)
WD40 repeat 190..225 CDD:293791 9/35 (26%)
WD40 repeat 231..266 CDD:293791 7/46 (15%)
WD40 repeat 272..308 CDD:293791 14/31 (45%)
CG7568NP_001263071.1 WD40 93..466 CDD:225201 71/314 (23%)
WD40 repeat 122..158 CDD:293791 1/6 (17%)
WD40 154..467 CDD:238121 70/311 (23%)
WD40 repeat 189..222 CDD:293791 10/44 (23%)
WD40 repeat 228..265 CDD:293791 8/37 (22%)
WD40 repeat 270..306 CDD:293791 7/39 (18%)
WD40 repeat 314..348 CDD:293791 7/34 (21%)
WD40 repeat 355..393 CDD:293791 4/39 (10%)
WD40 repeat 400..436 CDD:293791 14/31 (45%)
WD40 repeat 442..466 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR44156
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.