DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wmd and strap

DIOPT Version :9

Sequence 1:NP_001097436.1 Gene:wmd / 37727 FlyBaseID:FBgn0034876 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001120495.1 Gene:strap / 100145616 XenbaseID:XB-GENE-996947 Length:327 Species:Xenopus tropicalis


Alignment Length:310 Identity:190/310 - (61%)
Similarity:240/310 - (77%) Gaps:0/310 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LRQIPLTCSGHTRPVVHLDFSDICDAGYFLISACKDGSPMLRHGDTGDWVGTFEGHKGAVWNATL 70
            :||.||||||||||||.|.||.:...|:|||||||||.||||.||||||:|||.|||||||.|||
 Frog     1 MRQTPLTCSGHTRPVVDLAFSPVTPYGFFLISACKDGKPMLRQGDTGDWIGTFLGHKGAVWGATL 65

  Fly    71 NRNATLAASGAADFTGKVWNAVTGAEIHSFQHKHIVKSVAFDRDSENIVTGSNEKLVRVFNLEQP 135
            ||:||.||:.|||||.|||:||||.|:.:..||||||||.|..||.|::||..:|::|::::.:|
 Frog    66 NRDATKAATAAADFTAKVWDAVTGDELITLAHKHIVKSVDFTEDSNNLLTGGQDKVLRIYDMNKP 130

  Fly   136 EAQPEEYAGHTGAIKRALFCRGDKCIISAAEDKTVRLWDRMTGIEVQRLQFNSNPNSLEISSDNH 200
            ||:|.|.:|||.|||:||:...|..|:||::|||||||||::..||:.|||..:.:|:|...:..
 Frog   131 EAEPWEISGHTSAIKKALWYNNDNQILSASDDKTVRLWDRVSMTEVKTLQFGVSVSSMEYIPEGE 195

  Fly   201 ILTISHGSSISFWEIDTLKKLKEVKVPTNVASASLHPDKHVFVCGGEDFKMYKFDYITGNEIESF 265
            .|.|::|.:|:.:...:|..:|..:.|..:.||||||||...|.||:|||:||:|:.||.|:||:
 Frog   196 ALLITYGRTIALYNALSLDLIKSFEAPAPINSASLHPDKECIVAGGDDFKLYKYDFTTGEELESY 260

  Fly   266 KGHFGPVHSVKFSPDGELYASGSEDGTLRLWQTTVGKTYGLWKCTEPADL 315
            ||||||||.|:||||||||||||||||||||||.||||||||||..|.:|
 Frog   261 KGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTAVGKTYGLWKCVLPEEL 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wmdNP_001097436.1 WD40 12..297 CDD:238121 171/284 (60%)
WD40 repeat 25..60 CDD:293791 25/34 (74%)
WD40 repeat 66..101 CDD:293791 23/34 (68%)
WD40 repeat 108..144 CDD:293791 15/35 (43%)
WD40 repeat 150..186 CDD:293791 19/35 (54%)
WD40 repeat 190..225 CDD:293791 8/34 (24%)
WD40 repeat 231..266 CDD:293791 22/34 (65%)
WD40 repeat 272..308 CDD:293791 32/35 (91%)
strapNP_001120495.1 WD40 7..292 CDD:238121 171/284 (60%)
WD40 <9..291 CDD:225201 168/281 (60%)
WD40 repeat 16..54 CDD:293791 26/37 (70%)
WD40 repeat 102..139 CDD:293791 16/36 (44%)
WD40 repeat 144..180 CDD:293791 19/35 (54%)
WD40 repeat 186..220 CDD:293791 8/33 (24%)
WD40 repeat 225..261 CDD:293791 22/35 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I8153
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H43881
Inparanoid 1 1.050 410 1.000 Inparanoid score I1819
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1239790at2759
OrthoFinder 1 1.000 - - FOG0005164
OrthoInspector 1 1.000 - - oto103332
Panther 1 1.100 - - O PTHR44156
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3682
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.