DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Menl-2 and SPAC750.08c

DIOPT Version :9

Sequence 1:NP_001027424.2 Gene:Menl-2 / 3772692 FlyBaseID:FBgn0029153 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_595034.1 Gene:SPAC750.08c / 2542710 PomBaseID:SPAC750.08c Length:228 Species:Schizosaccharomyces pombe


Alignment Length:210 Identity:64/210 - (30%)
Similarity:108/210 - (51%) Gaps:13/210 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   375 KIFIKSMEPMK-------DMMAVLKKLKPSVLVGATGVGGIFNEEVLKTMAKNHERPAVFPLSNP 432
            |.|:|.....|       |:...:..:||:||:|.:|..|.|.|:.::.|:|:.:.|.:||:|||
pombe    19 KPFLKKDSDFKEVPSGDIDLETAISLIKPTVLLGCSGQPGKFTEKAIREMSKHVKHPIIFPISNP 83

  Fly   433 TANSECTAEQAFTHTEGRVLFGSGSPFPPVVINGKRYRPAQANNCLTFPGIALAAITAKARYLPN 497
            |...|....|....:.|:.|..:|||.||:..|||.|..:|.||.|.:|.:.:|.:.::.:.|.:
pombe    84 TTLMEAKPVQIDEWSNGKALMATGSPLPPLTRNGKEYVISQCNNALLYPALGVACVLSRCKLLSD 148

  Fly   498 EVFSVVSHELARNTPQELL--DEGTLFPPIKDAHNVAFNVGVAMTQYLIDNDLSNV-YPKPD-DI 558
            .:....|..|| ..|:.|.  || .|.|.:.:|..::.::..|:.:..|...:|.| .||.| .:
pombe   149 GMLKAASDALA-TVPRSLFVADE-ALLPDLDNAREISRHIVFAVLKQAISEGMSTVDLPKDDAKL 211

  Fly   559 CEFVKRSLYKFDYRN 573
            .|::....:..:|||
pombe   212 KEWIIEREWNPEYRN 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Menl-2NP_001027424.2 PLN03129 8..573 CDD:215594 62/208 (30%)
malic 102..283 CDD:278802
NADB_Rossmann 293..567 CDD:304358 61/202 (30%)
SPAC750.08cNP_595034.1 NADB_Rossmann <1..222 CDD:304358 61/204 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 147 1.000 Domainoid score I1122
eggNOG 1 0.900 - - E1_COG0281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000475
OrthoInspector 1 1.000 - - mtm9297
orthoMCL 1 0.900 - - OOG6_100205
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.