DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kaz1-ORFB and Spink12

DIOPT Version :10

Sequence 1:NP_001027091.1 Gene:Kaz1-ORFB / 3772691 FlyBaseID:FBgn0063923 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_084337.2 Gene:Spink12 / 78242 MGIID:1925492 Length:87 Species:Mus musculus


Alignment Length:88 Identity:22/88 - (25%)
Similarity:33/88 - (37%) Gaps:26/88 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SGLALLLIGMAQCYPQFD--SENPWLRPRQPTEPTISPNAGGSTPANAAPPTTQSPRYFACFHSC 71
            :|..||||.:|..:...|  |:..:.......|.|::|:.                      .||
Mouse     4 AGAFLLLISLACLFLSVDAVSQGGFQAFCSNYEKTLAPDG----------------------KSC 46

  Fly    72 PATSEYNPICGSDNVNYYNENKF 94
            |.|  :.|:||:|...|.|...|
Mouse    47 PKT--HKPVCGTDGKTYQNRCAF 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kaz1-ORFBNP_001027091.1 MFS <43..90 CDD:475125 10/46 (22%)
KAZAL_FS 69..>99 CDD:412159 11/26 (42%)
Spink12NP_084337.2 KAZAL_PSTI 42..87 CDD:238648 11/50 (22%)

Return to query results.
Submit another query.