DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kaz1-ORFB and Spink2

DIOPT Version :10

Sequence 1:NP_001027091.1 Gene:Kaz1-ORFB / 3772691 FlyBaseID:FBgn0063923 Length:115 Species:Drosophila melanogaster
Sequence 2:XP_011247866.1 Gene:Spink2 / 69982 MGIID:1917232 Length:88 Species:Mus musculus


Alignment Length:31 Identity:13/31 - (41%)
Similarity:16/31 - (51%) Gaps:6/31 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 FHSCPATSEYNPICGSDNVNYYNENKFNCAL 98
            |.:||  ...||:||:|...|.||    |.|
Mouse    45 FPACP--RNLNPVCGTDMNTYSNE----CTL 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kaz1-ORFBNP_001027091.1 MFS <43..90 CDD:475125 9/21 (43%)
KAZAL_FS 69..>99 CDD:412159 12/30 (40%)
Spink2XP_011247866.1 Kazal_1 40..88 CDD:395004 13/31 (42%)

Return to query results.
Submit another query.