DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33640 and CG14518

DIOPT Version :10

Sequence 1:NP_001027255.2 Gene:CG33640 / 3772680 FlyBaseID:FBgn0053640 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster


Alignment Length:81 Identity:18/81 - (22%)
Similarity:33/81 - (40%) Gaps:9/81 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 LYNVQLNFCSVLNNGYKNKFIRMLYNNYAQFLNTKPKCP---LKPNFNYSLHRAYIDEAMLPDLL 147
            ||:|..:.|..:.. ..|..||:::..:.::......||   |:...|:     |:....||..:
  Fly    87 LYSVSFDGCQFIRR-RNNALIRIVWELFKEYSTINHTCPYVGLQQVKNF-----YLRSEKLPTPI 145

  Fly   148 PECTYRLKMSFKHKSK 163
            |...|.|.:.:....|
  Fly   146 PTGEYLLMIDWVFNKK 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33640NP_001027255.2 DUF1091 73..154 CDD:461928 16/70 (23%)
CG14518NP_651653.2 DM8 83..173 CDD:214778 18/81 (22%)

Return to query results.
Submit another query.