DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33640 and CG14456

DIOPT Version :9

Sequence 1:NP_001027255.2 Gene:CG33640 / 3772680 FlyBaseID:FBgn0053640 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001137998.1 Gene:CG14456 / 40481 FlyBaseID:FBgn0037176 Length:213 Species:Drosophila melanogaster


Alignment Length:136 Identity:32/136 - (23%)
Similarity:55/136 - (40%) Gaps:25/136 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 FTVDDRDLFLSQSAVVEQDGNRSYLSGHMMINRLVNDLTLTSSMDITRPQRPELRL-YNVQLNFC 94
            |..|::  |:|...|  .|.:..:|:..|.:::.::|:.:...:.||..|.|.... .|..||.|
  Fly    34 FWSDEK--FVSHKVV--YDNSDPHLNFSMEVHQELHDVDIHVEVRITNKQDPYYNTNLNTTLNVC 94

  Fly    95 SVLNNGYKNKFIRMLYNNYAQFLNTKPKCPLKPNFNYSLHRAYIDE------------------- 140
            .:|....|:...|.::....:|.|....||:... .|..||.::..                   
  Fly    95 RILGFANKSPVGRFVHGFIREFGNIVETCPIAKG-RYHWHRIHLKRKLQGSYFINKFWWPEDPTT 158

  Fly   141 AMLPDL 146
            ||||:|
  Fly   159 AMLPEL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33640NP_001027255.2 DUF1091 73..154 CDD:284008 23/94 (24%)
CG14456NP_001137998.1 DM8 82..189 CDD:214778 19/84 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.