DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33640 and CG33632

DIOPT Version :10

Sequence 1:NP_001027255.2 Gene:CG33640 / 3772680 FlyBaseID:FBgn0053640 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001036537.1 Gene:CG33632 / 3885590 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster


Alignment Length:174 Identity:44/174 - (25%)
Similarity:67/174 - (38%) Gaps:38/174 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KLRLLVFSSLINCSLCAHVVFVDHFTFTVD----DRDLFLSQSAVVEQDGNRSYLSGHMMINRLV 65
            ||:|.|...||.......|..:..|| .|.    |:|..|.:...: |..||||....:.:..|.
  Fly     4 KLKLCVAFQLICIYYLTEVYSLVEFT-NVQCETLDKDFSLFEYCYL-QSVNRSYKYVSLKVKLLK 66

  Fly    66 NDLT-------LTSSMDITRPQRPELRLYNVQLNFCSVLNNGYKNKFIRMLYNNYAQFLNTKPKC 123
            ..:|       |...::..:|     .|||:.|:.|..|.:...|......||.:..:.|....|
  Fly    67 IPVTKIKVQFGLYKRLNGYKP-----FLYNMTLDGCRFLKSRNPNPIALYFYNLFKDYSNINHTC 126

  Fly   124 PLKPNFNYSLHRAYIDE-----------AMLPDLLPECTYRLKM 156
            |    :|:.|   .:||           .:||  .||..|:|::
  Fly   127 P----YNHDL---VLDEMSYHSINYKLTEILP--FPEGNYKLEV 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33640NP_001027255.2 DUF1091 73..154 CDD:461928 22/91 (24%)
CG33632NP_001036537.1 DUF1091 78..159 CDD:461928 23/94 (24%)

Return to query results.
Submit another query.