DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33640 and CG33725

DIOPT Version :10

Sequence 1:NP_001027255.2 Gene:CG33640 / 3772680 FlyBaseID:FBgn0053640 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027125.1 Gene:CG33725 / 3772600 FlyBaseID:FBgn0053725 Length:181 Species:Drosophila melanogaster


Alignment Length:83 Identity:19/83 - (22%)
Similarity:37/83 - (44%) Gaps:18/83 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 LYNVQLNFCSVLNNGYKNKFIRMLYNNYAQFLNTKPKCPLKPNFNYSLHRAYIDEAMLPD--LLP 148
            |.:|:|:.|..:...: :.|:|::::.:..|......||            |:...::.|  |.|
  Fly    89 LLDVKLDACRFVRTNF-HPFVRIIFDLFKDFSTINHTCP------------YVGLQVVKDFYLRP 140

  Fly   149 ECTYRLKMSFKHKSKLLA 166
            |   :||:.|.....||:
  Fly   141 E---KLKLPFPSGDYLLS 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33640NP_001027255.2 DUF1091 73..154 CDD:461928 14/69 (20%)
CG33725NP_001027125.1 DUF1091 74..154 CDD:461928 17/80 (21%)

Return to query results.
Submit another query.