DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33640 and CG33679

DIOPT Version :10

Sequence 1:NP_001027255.2 Gene:CG33640 / 3772680 FlyBaseID:FBgn0053640 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027273.1 Gene:CG33679 / 3772494 FlyBaseID:FBgn0053679 Length:173 Species:Drosophila melanogaster


Alignment Length:95 Identity:26/95 - (27%)
Similarity:42/95 - (44%) Gaps:14/95 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 LYNVQLNFCSVLNNGYKNKFIRMLYNNYAQFL---NTKPKCPLKPNFNYSLHRAYIDEAMLPDL- 146
            |:||....|.||.  |.|: :|:.|..|..|:   |....||.  |.:..:....:|:.|...: 
  Fly    82 LFNVSEEHCRVLR--YPNR-LRVFYYFYTAFMPFSNINHTCPY--NDDIYIRNCTLDDRMFAKVP 141

  Fly   147 LPECTYRLKMSFKHK-----SKLLAHMQID 171
            ||:.:|:|.:.....     |.:..|.:||
  Fly   142 LPKGSYKLTLEMDDGVVNWISIINIHFEID 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33640NP_001027255.2 DUF1091 73..154 CDD:461928 21/71 (30%)
CG33679NP_001027273.1 DUF1091 70..149 CDD:461928 21/71 (30%)

Return to query results.
Submit another query.