DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33640 and CG33700

DIOPT Version :10

Sequence 1:NP_001027255.2 Gene:CG33640 / 3772680 FlyBaseID:FBgn0053640 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027121.3 Gene:CG33700 / 3772390 FlyBaseID:FBgn0053700 Length:175 Species:Drosophila melanogaster


Alignment Length:148 Identity:36/148 - (24%)
Similarity:57/148 - (38%) Gaps:39/148 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FLSQSAVVEQDGN-------------RSYLSGHMMINRLVNDLTLTSSMDI-------TRPQRPE 83
            |..|:.:.|...|             |..::...|:.:|.|  ....|:||       :...|| 
  Fly    23 FQLQNVICESFDNAITNFSRCEMKFIRRGVAAFYMVWKLYN--VPIKSVDINVALYKKSNGYRP- 84

  Fly    84 LRLYNVQLNFCSVLNNGYKNKFIRMLYNNYAQFLNTKPKCPLKPNFNYSLHRAYIDEAM-----L 143
             .|:|..|:||..:.|...:..|.|::..:.|..|....||..       |...|:|.:     |
  Fly    85 -FLFNQTLDFCYYMRNPRAHPLIYMMHKVFMQASNINHSCPYD-------HDLIINEFIYKKNDL 141

  Fly   144 PDL-LPECTY--RLKMSF 158
            .|| :|...|  |:|::|
  Fly   142 KDLPIPNGDYMIRVKVAF 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33640NP_001027255.2 DUF1091 73..154 CDD:461928 25/95 (26%)
CG33700NP_001027121.3 DUF1091 71..153 CDD:461928 23/90 (26%)

Return to query results.
Submit another query.