DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33640 and CG33792

DIOPT Version :10

Sequence 1:NP_001027255.2 Gene:CG33640 / 3772680 FlyBaseID:FBgn0053640 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027411.2 Gene:CG33792 / 3772111 FlyBaseID:FBgn0053792 Length:225 Species:Drosophila melanogaster


Alignment Length:163 Identity:30/163 - (18%)
Similarity:62/163 - (38%) Gaps:53/163 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 AVVEQDGNRSYLSGHMMINRLVNDLTLT------SSMDITRPQRPELRLYNVQLNF--CSVLNNG 100
            :|:..||:         |...:.|:.::      .|.::.:|       :.|:..|  |.:|.|.
  Fly    60 SVLNMDGD---------IKEALTDIKMSVEVFYKDSSNLYKP-------FAVKFKFDVCQLLKNK 108

  Fly   101 YKNKFI-RMLYNNYAQFLNTKPKCPLKPNF------NYSLHRAYI---------------DEAML 143
            .::.|: :...::..::.|....||.:.:.      .:|.:..||               ||..|
  Fly   109 TQSNFLQKYAISHLTEWTNVNHSCPYRVSLCIYNIVKFSQYIEYIYMFLKGHLIARNFRLDEVSL 173

  Fly   144 PDLLPECTYRLKMSFK------HKSKLLAHMQI 170
            | :||...|::..:|.      |...:|.:.:|
  Fly   174 P-ILPIQDYKIAFNFSGANPGIHLGLVLIYFEI 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33640NP_001027255.2 DUF1091 73..154 CDD:461928 21/104 (20%)
CG33792NP_001027411.2 DUF1091 82..183 CDD:461928 21/108 (19%)

Return to query results.
Submit another query.