DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33640 and CG33641

DIOPT Version :9

Sequence 1:NP_001027255.2 Gene:CG33640 / 3772680 FlyBaseID:FBgn0053640 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027256.1 Gene:CG33641 / 3771970 FlyBaseID:FBgn0053641 Length:181 Species:Drosophila melanogaster


Alignment Length:155 Identity:40/155 - (25%)
Similarity:76/155 - (49%) Gaps:1/155 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VFVDHFTFTVDDRDLFLSQSAVVEQDGNRSYLSGHMMINRLVNDLTLTSSMDITRPQ-RPELRLY 87
            :|.|.|.......|:|......:.|..||||::..|.:.:.|:||.:.:.|:..:|. :.:::||
  Fly    26 IFFDEFAIKYKVPDIFEKMDCNLYQANNRSYVNVEMKLKKEVSDLNVRAIMEFWKPNAQNKMKLY 90

  Fly    88 NVQLNFCSVLNNGYKNKFIRMLYNNYAQFLNTKPKCPLKPNFNYSLHRAYIDEAMLPDLLPECTY 152
            :|:::.|.:|...:|||.......::.:..|....||.|.||.|.:...::||..||...|...:
  Fly    91 DVRVDGCLILRTIHKNKLFYFYVKSFKKHSNVVLSCPFKANFTYKMDDWFLDEEELPPFAPVGQF 155

  Fly   153 RLKMSFKHKSKLLAHMQIDGRLLSK 177
            |....:..:.:|:..:...|.:|.:
  Fly   156 RTVTEYFTQQRLIIRVVAHGAVLPR 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33640NP_001027255.2 DUF1091 73..154 CDD:284008 22/81 (27%)
CG33641NP_001027256.1 DUF1091 80..156 CDD:284008 21/75 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FA0X
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007613
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.