DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33640 and CG33702

DIOPT Version :10

Sequence 1:NP_001027255.2 Gene:CG33640 / 3772680 FlyBaseID:FBgn0053640 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027120.1 Gene:CG33702 / 3771932 FlyBaseID:FBgn0053702 Length:179 Species:Drosophila melanogaster


Alignment Length:173 Identity:36/173 - (20%)
Similarity:61/173 - (35%) Gaps:47/173 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 EYCGPVVATF-CPLLI-------FEGS------LKLFHAYDVFKRSTYRTVWTEQLLSASEWLWL 282
            |.|.||...: |.|.:       |.||      :||...:|    :.|..:..::.|    :.:|
  Fly   263 EGCDPVNKVYHCDLSLLPKGLEGFRGSNTLLPFVKLIDTFD----AQYIAIANDETL----FTFL 319

  Fly   283 SFDVKKLFVVLYVSEVLKQKVEETALCTRHFDDYRLQNTRAAKQIQNFLLKNLHQKKKF------ 341
            :......:.|:.|.  ||:....|.:...|..|  :.:|.:|......::..:...|..      
  Fly   320 TNKDAPKYKVVRVD--LKEPSSWTDVIAEHEKD--VLSTASAVNGDQLVVSYMSDVKHILQIRDL 380

  Fly   342 --------------SACGFF-DIDNTVIYMVFSSIVTYLVILI 369
                          |.||.| ...:|..:..|:|.:|..||.|
  Fly   381 KSGSLLHGLPVDIGSVCGVFARRKDTTFFFRFTSFLTPGVIYI 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33640NP_001027255.2 DUF1091 73..154 CDD:461928
CG33702NP_001027120.1 DUF1091 73..158 CDD:461928
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.