DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33640 and CG33796

DIOPT Version :10

Sequence 1:NP_001027255.2 Gene:CG33640 / 3772680 FlyBaseID:FBgn0053640 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster


Alignment Length:75 Identity:23/75 - (30%)
Similarity:33/75 - (44%) Gaps:7/75 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 LYNVQLNFCSVLNNGYKNKFIRMLYNNYAQFLNTKPKCPLKPNFNYSLHRAYI--DEAMLPDLLP 148
            |.|.|::.|..|...|....| :|:|.|..|.|....|||:.:.  .:...|:  |...||  ||
  Fly    89 LVNTQIDGCRFLRKPYDALGI-LLFNIYRNFTNINHTCPLQGDM--IVRNMYLTTDVMRLP--LP 148

  Fly   149 ECTYRLKMSF 158
            ...|.|.:.:
  Fly   149 TGDYLLAIDW 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33640NP_001027255.2 DUF1091 73..154 CDD:461928 22/69 (32%)
CG33796NP_001027128.1 DUF1091 74..154 CDD:461928 22/69 (32%)

Return to query results.
Submit another query.