DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33640 and CG33920

DIOPT Version :10

Sequence 1:NP_001027255.2 Gene:CG33640 / 3772680 FlyBaseID:FBgn0053640 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027214.1 Gene:CG33920 / 3771875 FlyBaseID:FBgn0053920 Length:180 Species:Drosophila melanogaster


Alignment Length:79 Identity:20/79 - (25%)
Similarity:31/79 - (39%) Gaps:7/79 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 NRSYLSGHMMINRLVNDLTLTSSMDITR-----PQRPELRLYNVQLNFCSVLNNGYKNKFIRMLY 110
            ||||....:........:|..:.:.:.|     ..||  .::|:.|:.|..:||...|.....||
  Fly    51 NRSYKYVSIKAKLFKTPITKINGVILKRFNGYNGYRP--FMFNITLDACRFMNNTKSNPIASYLY 113

  Fly   111 NNYAQFLNTKPKCP 124
            :....|.|....||
  Fly   114 DFIRPFTNMNHNCP 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33640NP_001027255.2 DUF1091 73..154 CDD:461928 15/57 (26%)
CG33920NP_001027214.1 DUF1091 71..158 CDD:461928 15/59 (25%)

Return to query results.
Submit another query.