DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33640 and CG14492

DIOPT Version :10

Sequence 1:NP_001027255.2 Gene:CG33640 / 3772680 FlyBaseID:FBgn0053640 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_611275.2 Gene:CG14492 / 37045 FlyBaseID:FBgn0034283 Length:199 Species:Drosophila melanogaster


Alignment Length:162 Identity:42/162 - (25%)
Similarity:75/162 - (46%) Gaps:21/162 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DHFTFTVDDRDLFLSQSAVVE-------QDGNRSYLSGHM--MINRLV--NDLTLTSSMDITRPQ 80
            |:||.:.||    :|.|.:.|       ....|::   ||  ::.:.|  :|..:...:...|| 
  Fly    37 DNFTCSSDD----ISSSVLKEFTCGISKSTKRRTW---HMEFVLEQPVAEHDFFIKIVLPRRRP- 93

  Fly    81 RPELRLYNVQLNFCSVLNNGYKNKFIRMLYNNYAQFLNTKPKCPLKPNFNYSLHRAYIDEAMLPD 145
            .|:..|.||..:.|.:|.|..:...:|:..|...:|.|...:||.||||.|.:....:|..::|.
  Fly    94 LPDFVLLNVTTDGCQLLANRNQVPLMRLGRNIMERFSNFPKQCPFKPNFTYYIRGFRLDLNLVPA 158

  Fly   146 LLPECTYRLKMSFKHKSKLLAHMQIDGRLLSK 177
            :..|..  :::.|.|::|......|.|.|:::
  Fly   159 VDMETP--VQIEFSHQNKQQGIRWITGYLMAR 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33640NP_001027255.2 DUF1091 73..154 CDD:461928 23/80 (29%)
CG14492NP_611275.2 DM8 95..186 CDD:214778 26/92 (28%)

Return to query results.
Submit another query.