DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33640 and CG13193

DIOPT Version :10

Sequence 1:NP_001027255.2 Gene:CG33640 / 3772680 FlyBaseID:FBgn0053640 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster


Alignment Length:97 Identity:24/97 - (24%)
Similarity:46/97 - (47%) Gaps:5/97 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 INR-LVNDL--TLTSSMDITRPQRPELRLYNVQLNFCSVLNNGYKNKFIRMLYNNYAQFLNTKPK 122
            :|| |.|.|  |:|....|....|.: .|::..::.|..|....::..:::...|..::.|...:
  Fly    68 LNRTLKNGLRTTITLLQLIDGKDRYQ-TLFSYDMDTCKTLRELLQSSLMKVWLRNVFKYGNLADR 131

  Fly   123 CPLKPNFNYSLHRAYIDEAMLPDLLPECTYRL 154
            ||::| .:|.:....::...:|..||...|||
  Fly   132 CPIQP-ASYDVRNFQLENHSIPGYLPAGFYRL 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33640NP_001027255.2 DUF1091 73..154 CDD:461928 15/80 (19%)
CG13193NP_610699.1 DM8 91..183 CDD:214778 16/74 (22%)

Return to query results.
Submit another query.