DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33640 and CG33453

DIOPT Version :10

Sequence 1:NP_001027255.2 Gene:CG33640 / 3772680 FlyBaseID:FBgn0053640 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_995888.1 Gene:CG33453 / 2768851 FlyBaseID:FBgn0053453 Length:175 Species:Drosophila melanogaster


Alignment Length:85 Identity:20/85 - (23%)
Similarity:33/85 - (38%) Gaps:6/85 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 LYNVQLNFCSVLNNGYKNKFIRMLYNNYAQFLNTKPKCPLKPNFNYSLHRAYIDEAMLPDLLPEC 150
            |::|.::.|..|...: |..|:|.|:....:......||.........|     .|:.|..||..
  Fly    89 LFDVTIDACQFLRKRH-NPVIKMFYSFIKDYSTLNHTCPYGLQVVSDYH-----TAVFPVPLPSG 147

  Fly   151 TYRLKMSFKHKSKLLAHMQI 170
            .|.:.:.|...:|...|:.|
  Fly   148 DYGVLLDFIFYAKKQFHVNI 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33640NP_001027255.2 DUF1091 73..154 CDD:461928 16/67 (24%)
CG33453NP_995888.1 DUF1091 78..149 CDD:461928 15/65 (23%)

Return to query results.
Submit another query.