DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33640 and CG33467

DIOPT Version :10

Sequence 1:NP_001027255.2 Gene:CG33640 / 3772680 FlyBaseID:FBgn0053640 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001286440.1 Gene:CG33467 / 2768834 FlyBaseID:FBgn0053467 Length:188 Species:Drosophila melanogaster


Alignment Length:166 Identity:32/166 - (19%)
Similarity:63/166 - (37%) Gaps:31/166 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FSSLINCSLCAHVVFVDHFTFTVDDRDLFLSQSAVVEQDGNRSYLSGHMMINRLVNDLTLTSSMD 75
            ::.|:..|:|    |:.|.|    |..| :.:...||..||::.:.......:.:|..|...::|
  Fly     3 YTWLVLLSIC----FIGHMT----DSQL-VYKFTKVECQGNQARVKNVSCNVKPINWNTALVNLD 58

  Fly    76 --ITRPQ-RPELR---------------LYNVQLNFCSVLNNGYKNKFIRMLYNNYAQFLNTKPK 122
              :..|. .|.:|               |.:.....|.|:.......:..|::..:.:|.|.| .
  Fly    59 CYLIYPLINPTIRVQVFMKDYSNQYKPFLIDATFKLCDVVERKNFLPYAVMVWELFQRFTNVK-S 122

  Fly   123 CPLKPNFNYSLHRAYIDEAMLPDLLPECTYRLKMSF 158
            |.:....  |....|::.:.:|. .|...|::.:.|
  Fly   123 CHISGQL--SARNGYLNSSYVPP-FPHGQYQISVMF 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33640NP_001027255.2 DUF1091 73..154 CDD:461928 17/98 (17%)
CG33467NP_001286440.1 DUF1091 70..151 CDD:461928 14/84 (17%)

Return to query results.
Submit another query.