DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33640 and CG33476

DIOPT Version :10

Sequence 1:NP_001027255.2 Gene:CG33640 / 3772680 FlyBaseID:FBgn0053640 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_995798.2 Gene:CG33476 / 2768727 FlyBaseID:FBgn0053476 Length:165 Species:Drosophila melanogaster


Alignment Length:143 Identity:33/143 - (23%)
Similarity:54/143 - (37%) Gaps:36/143 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 CAHVVFVDHFTFTVDDRDLFLSQSAVVEQDGNRSYLSGHMMINRLVNDLTLTSSMDITRPQRPEL 84
            |.| .||::|....|..|::.                  ..:.:|....|:..::.:.:.:|.  
  Fly    28 CDH-NFVEYFHKAPDMVDIYT------------------FRVVKLAKAFTIDFAVRVVKTKRV-- 71

  Fly    85 RLYNVQLNF--CSVLNNGYKNKFIRMLYN----NYAQFLNTKPKCPLKPNFNYSLHRAYIDEAML 143
             :|.|. ||  |..|.|...|:....:|.    |.:.|     .||:||...|..:...:  |||
  Fly    72 -MYKVD-NFDGCQFLMNPLMNRVFGTVYKRLVVNGSFF-----SCPIKPGVYYIRNEGSV--AML 127

  Fly   144 PDLLPECTYRLKM 156
            |...|...|::.|
  Fly   128 PVFQPPGRYQITM 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33640NP_001027255.2 DUF1091 73..154 CDD:461928 23/86 (27%)
CG33476NP_995798.2 DUF1091 57..138 CDD:461928 24/91 (26%)

Return to query results.
Submit another query.