DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snapin and AT1G79070

DIOPT Version :9

Sequence 1:NP_722835.1 Gene:Snapin / 3772677 FlyBaseID:FBgn0031455 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001320379.1 Gene:AT1G79070 / 844248 AraportID:AT1G79070 Length:138 Species:Arabidopsis thaliana


Alignment Length:122 Identity:27/122 - (22%)
Similarity:59/122 - (48%) Gaps:2/122 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SDSTVTSLEENT-ENFCTNPTRDILAEGITNLFKPTIERLDERVASTIQLQAELRGQLDALAAQL 66
            :|:|.:|.:..| |:.......:.:|.|::.:.:..|:..|.:...|:..|.||.|.||.|..:|
plant    13 ADATTSSCQSTTAEDGQCGGGGEAMARGLSAMLESVIKDFDSKALDTLNSQDELSGSLDRLVQEL 77

  Fly    67 RDIEKAQSQIPEFADKVKELLNVKHKVTVISNVLVTSQERLTGLHKLIEKEQRRRQA 123
            ..:.: .:.:|........:.:||.:|:.::.||.:.|.|:..:..::.....:.:|
plant    78 DQLLE-NAPLPFIVQHASRISSVKQRVSSLNLVLKSVQRRIDNIDHMLSANTTQEKA 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SnapinNP_722835.1 Snapin_Pallidin 25..111 CDD:405411 21/85 (25%)
AT1G79070NP_001320379.1 Snapin_Pallidin 35..121 CDD:373241 21/86 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006525
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105887
Panther 1 1.100 - - LDO PTHR31305
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.