DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snapin and Snapin

DIOPT Version :9

Sequence 1:NP_722835.1 Gene:Snapin / 3772677 FlyBaseID:FBgn0031455 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001164047.1 Gene:Snapin / 295217 RGDID:1560377 Length:136 Species:Rattus norvegicus


Alignment Length:110 Identity:43/110 - (39%)
Similarity:68/110 - (61%) Gaps:1/110 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PT-RDILAEGITNLFKPTIERLDERVASTIQLQAELRGQLDALAAQLRDIEKAQSQIPEFADKVK 84
            || ||:.|||:....:|.:::||..|.:..:.|.|||.|:|.||.:|..|.:.|....:....||
  Rat    19 PTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVK 83

  Fly    85 ELLNVKHKVTVISNVLVTSQERLTGLHKLIEKEQRRRQALLDSAL 129
            :|||.:.:|.:::|:|..:||||..|:..:.||..||:|:|||.:
  Rat    84 KLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGV 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SnapinNP_722835.1 Snapin_Pallidin 25..111 CDD:405411 30/85 (35%)
SnapinNP_001164047.1 Snapin_Pallidin 24..110 CDD:405411 31/85 (36%)
Interaction with TOR1A. /evidence=ECO:0000250 83..136 19/45 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341880
Domainoid 1 1.000 62 1.000 Domainoid score I10129
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I5113
OMA 1 1.010 - - QHG48273
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006525
OrthoInspector 1 1.000 - - oto98714
orthoMCL 1 0.900 - - OOG6_105887
Panther 1 1.100 - - LDO PTHR31305
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.860

Return to query results.
Submit another query.