DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snapin and SNAPIN

DIOPT Version :9

Sequence 1:NP_722835.1 Gene:Snapin / 3772677 FlyBaseID:FBgn0031455 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_036569.1 Gene:SNAPIN / 23557 HGNCID:17145 Length:136 Species:Homo sapiens


Alignment Length:110 Identity:43/110 - (39%)
Similarity:68/110 - (61%) Gaps:1/110 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PT-RDILAEGITNLFKPTIERLDERVASTIQLQAELRGQLDALAAQLRDIEKAQSQIPEFADKVK 84
            || ||:.|||:....:|.:::||..|.:..:.|.|||.|:|.||.:|..|.:.|....:....||
Human    19 PTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVK 83

  Fly    85 ELLNVKHKVTVISNVLVTSQERLTGLHKLIEKEQRRRQALLDSAL 129
            :|||.:.:|.:::|:|..:||||..|:..:.||..||:|:|||.:
Human    84 KLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGI 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SnapinNP_722835.1 Snapin_Pallidin 25..111 CDD:405411 30/85 (35%)
SNAPINNP_036569.1 Snapin_Pallidin 23..110 CDD:373241 31/86 (36%)
Interaction with TOR1A 83..136 20/46 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148006
Domainoid 1 1.000 62 1.000 Domainoid score I10415
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5207
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48273
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006525
OrthoInspector 1 1.000 - - oto91643
orthoMCL 1 0.900 - - OOG6_105887
Panther 1 1.100 - - LDO PTHR31305
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4762
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.890

Return to query results.
Submit another query.