DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snapin and snpn-1

DIOPT Version :9

Sequence 1:NP_722835.1 Gene:Snapin / 3772677 FlyBaseID:FBgn0031455 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_500721.1 Gene:snpn-1 / 177282 WormBaseID:WBGene00015327 Length:122 Species:Caenorhabditis elegans


Alignment Length:89 Identity:19/89 - (21%)
Similarity:46/89 - (51%) Gaps:7/89 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TIERLDERVASTIQLQAELRGQLDALAAQLRDIEKAQSQIP--EFADKVKE-LLNVKHKVTVISN 98
            :|.:|::::.:|...|.:|....:.:|..|||:.:.:..:.  .:..|:.: .:.|.:....:.:
 Worm    24 SITKLEQQIRATQLSQKKLNSDCETMAEYLRDLSEYKQPVDLLPYVGKLNDSTIRVNNTHQKLDD 88

  Fly    99 VLVTSQERLTGLHKLIEKEQRRRQ 122
            :|    ||||.|.:.|.:|..:::
 Worm    89 LL----ERLTKLQRQIARETYKKK 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SnapinNP_722835.1 Snapin_Pallidin 25..111 CDD:405411 16/76 (21%)
snpn-1NP_500721.1 Snapin_Pallidin 17..97 CDD:291383 16/76 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159950
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006525
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105887
Panther 1 1.100 - - LDO PTHR31305
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.