DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snapin and snapin

DIOPT Version :9

Sequence 1:NP_722835.1 Gene:Snapin / 3772677 FlyBaseID:FBgn0031455 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001120066.1 Gene:snapin / 100145066 XenbaseID:XB-GENE-5915889 Length:122 Species:Xenopus tropicalis


Alignment Length:108 Identity:42/108 - (38%)
Similarity:68/108 - (62%) Gaps:0/108 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NPTRDILAEGITNLFKPTIERLDERVASTIQLQAELRGQLDALAAQLRDIEKAQSQIPEFADKVK 84
            :|.||:.|||:..|.||.:::||..|.:..:.|.:||..:|.||::|..|.:.|....:....||
 Frog     4 SPGRDVFAEGLLELLKPAVQQLDSHVHAVRESQVDLREHIDNLASELCKINEDQKVALDLDPYVK 68

  Fly    85 ELLNVKHKVTVISNVLVTSQERLTGLHKLIEKEQRRRQALLDS 127
            :|||.:.:|.:::|:|..:||||..|:..:.||..||:|:|||
 Frog    69 KLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDS 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SnapinNP_722835.1 Snapin_Pallidin 25..111 CDD:405411 30/85 (35%)
snapinNP_001120066.1 Snapin_Pallidin 8..95 CDD:373241 31/86 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 65 1.000 Domainoid score I9892
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5019
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006525
OrthoInspector 1 1.000 - - oto105411
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.