DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ste24c and OMA1

DIOPT Version :9

Sequence 1:NP_001027433.1 Gene:ste24c / 3772676 FlyBaseID:FBgn0050462 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_013013.2 Gene:OMA1 / 853962 SGDID:S000001795 Length:345 Species:Saccharomyces cerevisiae


Alignment Length:49 Identity:13/49 - (26%)
Similarity:18/49 - (36%) Gaps:10/49 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 VAGVVCHELGHWKHGHFYKATIIMKIHFFITMGLFGLFFHSPQLYMAVG 350
            :|.|:.||..|....|  .|..:.|...:..:||.        ||...|
Yeast   197 IATVLAHEFAHQLARH--TAENLSKAPIYSLLGLV--------LYTVTG 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ste24cNP_001027433.1 Peptidase_M48_N 37..215 CDD:293100
HtpX 131..452 CDD:223575 13/49 (27%)
Peptidase_M48 229..441 CDD:299867 13/49 (27%)
OMA1NP_013013.2 M48C_Oma1_like 132..323 CDD:320690 13/49 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0501
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.