DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ste24c and OMA1

DIOPT Version :10

Sequence 1:NP_001027433.1 Gene:ste24c / 3772676 FlyBaseID:FBgn0050462 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_013013.2 Gene:OMA1 / 853962 SGDID:S000001795 Length:345 Species:Saccharomyces cerevisiae


Alignment Length:49 Identity:13/49 - (26%)
Similarity:18/49 - (36%) Gaps:10/49 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 VAGVVCHELGHWKHGHFYKATIIMKIHFFITMGLFGLFFHSPQLYMAVG 350
            :|.|:.||..|....|  .|..:.|...:..:||.        ||...|
Yeast   197 IATVLAHEFAHQLARH--TAENLSKAPIYSLLGLV--------LYTVTG 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ste24cNP_001027433.1 M48A_Zmpste24p_like 28..445 CDD:320702 13/49 (27%)
OMA1NP_013013.2 M48C_Oma1_like 132..323 CDD:320690 13/49 (27%)

Return to query results.
Submit another query.