powered by:
Protein Alignment ste24c and OMA1
DIOPT Version :9
Sequence 1: | NP_001027433.1 |
Gene: | ste24c / 3772676 |
FlyBaseID: | FBgn0050462 |
Length: | 456 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_013013.2 |
Gene: | OMA1 / 853962 |
SGDID: | S000001795 |
Length: | 345 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 49 |
Identity: | 13/49 - (26%) |
Similarity: | 18/49 - (36%) |
Gaps: | 10/49 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 302 VAGVVCHELGHWKHGHFYKATIIMKIHFFITMGLFGLFFHSPQLYMAVG 350
:|.|:.||..|....| .|..:.|...:..:||. ||...|
Yeast 197 IATVLAHEFAHQLARH--TAENLSKAPIYSLLGLV--------LYTVTG 235
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0501 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.