DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ste24c and AT3G27110

DIOPT Version :9

Sequence 1:NP_001027433.1 Gene:ste24c / 3772676 FlyBaseID:FBgn0050462 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_566808.1 Gene:AT3G27110 / 822330 AraportID:AT3G27110 Length:344 Species:Arabidopsis thaliana


Alignment Length:188 Identity:41/188 - (21%)
Similarity:68/188 - (36%) Gaps:60/188 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 QVVLPE--GTALYMEVKRVCDVVGFPMKRVFIIK-------TRTMQYSNAYFYGSCCLKRIVIFD 275
            |::|.|  ||::.:...::.|:.|..::...|:.       .|.....|||              
plant   109 QIMLLENIGTSVLVSKNQLSDLHGLLVEAAEILNIEAPDLYVRQSPVPNAY-------------- 159

  Fly   276 TLLLNKGKEPNEIHPYEVGRGLTNIQVAGVVCHELGHWK--HGHFYKATIIMKIHFFITMGLFGL 338
            ||.:: ||:|..:....:...||:.::..|:.|||||.|  ||      :.:.....:|:|.:  
plant   160 TLAIS-GKKPFIVVHTSLIELLTSAELQAVLAHELGHLKCDHG------VWLTFANILTLGAY-- 215

  Fly   339 FFHSPQLYMAVGFEPGVMPIIVGFIIVLKFALTPYLTLANVLMLWNLRRFEYAADKFA 396
                                     .|..|......||...|:.| ||..|...|:.|
plant   216 -------------------------TVPAFGQMIARTLEEQLLRW-LRSAELTCDRAA 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ste24cNP_001027433.1 Peptidase_M48_N 37..215 CDD:293100
HtpX 131..452 CDD:223575 41/188 (22%)
Peptidase_M48 229..441 CDD:299867 36/177 (20%)
AT3G27110NP_566808.1 M48_Ste24p_like 116..321 CDD:320684 38/181 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0501
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10120
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.