DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ste24c and Oma1

DIOPT Version :9

Sequence 1:NP_001027433.1 Gene:ste24c / 3772676 FlyBaseID:FBgn0050462 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_080185.1 Gene:Oma1 / 67013 MGIID:1914263 Length:521 Species:Mus musculus


Alignment Length:267 Identity:52/267 - (19%)
Similarity:85/267 - (31%) Gaps:98/267 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 VLPEGTALYMEVKR--------------------VCDVVGFPMKRVFIIKTRTMQYSNAYFYGSC 266
            :|||....|:.||.                    |..||..|....|::..              
Mouse   248 LLPERDPRYLTVKEMVYHLTQCNRDVPGISETNWVVHVVDSPAVNAFVLPN-------------- 298

  Fly   267 CLKRIVIFDTLLLNKGKEPNEIHPYEVGRGLTNIQVAGVVCHELGHWKHGH-FYKATIIMKIHFF 330
              .::.|| |.|||   ...::|           |::.::.||:.|...|| ..||:::..:.| 
Mouse   299 --GQVFIF-TGLLN---SVTDVH-----------QLSFLLGHEIAHAVLGHAAEKASLVHLLDF- 345

  Fly   331 ITMGLFGLFFHSPQLYMAVGFEPGVMPIIVGFIIVLKFALTPYLTLANVLMLW------------ 383
                 .|:.|                       :.:.:|:.|..:|| ||..|            
Mouse   346 -----LGMIF-----------------------LTMIWAICPRDSLA-VLGQWIQSKLQEYMFDR 381

  Fly   384 -NLRRFEYAADKFAHRMGYSIQLRMALVKIYADHMSFPVYDQCYAR---WHHTHPTILQRLAYQQ 444
             ..|..|..|||...::.......:....::...|.|......|.:   |..|||:...|..|..
Mouse   382 PYSRTLEAEADKVGLQLAAKACADVRASSVFWQQMEFSESLHGYPKLPEWLSTHPSHGNRAEYLD 446

  Fly   445 KLDVKAM 451
            :|..:|:
Mouse   447 RLIPQAL 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ste24cNP_001027433.1 Peptidase_M48_N 37..215 CDD:293100
HtpX 131..452 CDD:223575 52/267 (19%)
Peptidase_M48 229..441 CDD:299867 46/248 (19%)
Oma1NP_080185.1 Cardiolipin-binding. /evidence=ECO:0000269|PubMed:31819158 144..163
Stress-sensor region. /evidence=ECO:0000269|PubMed:24550258 161..191
M48C_Oma1_like 265..452 CDD:320690 45/247 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0501
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.