DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bbx and SOX14

DIOPT Version :9

Sequence 1:NP_001027087.1 Gene:bbx / 3772670 FlyBaseID:FBgn0024251 Length:769 Species:Drosophila melanogaster
Sequence 2:NP_004180.1 Gene:SOX14 / 8403 HGNCID:11193 Length:240 Species:Homo sapiens


Alignment Length:169 Identity:46/169 - (27%)
Similarity:71/169 - (42%) Gaps:31/169 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 TRPEHHARRPMNAFLIFCKRHRGIVKERYKTLENRAITKILGDWWAALDEQEKHCFTDLAQQNKD 355
            ::|..|.:||||||:::.:..|..:.:....:.|..|:|.||..|..|.|.||..:.|.|::.:.
Human     2 SKPSDHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDEAKRLRA 66

  Fly   356 AFFNANPNFKW--------------YKLPAP------PLRTLATRPSNASAGLLIPSEDQPQQQV 400
            .....:|::|:              |..|.|      ||:. |..|..||.|||...|.......
Human    67 QHMKEHPDYKYRPRRKPKNLLKKDRYVFPLPYLGDTDPLKA-AGLPVGASDGLLSAPEKARAFLP 130

  Fly   401 PTSLQVQWAERGEMPRAMLRPNYFKLADETQMGELSSLL 439
            |.|          .|.::|.|..|..:...:|||:...|
Human   131 PAS----------APYSLLDPAQFSSSAIQKMGEVPHTL 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bbxNP_001027087.1 SOX-TCF_HMG-box 296..367 CDD:238684 22/84 (26%)
SOX14NP_004180.1 SOX-TCF_HMG-box 7..78 CDD:238684 22/70 (31%)
SOXp 77..>118 CDD:403523 9/41 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.