DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bbx and Hbp1

DIOPT Version :9

Sequence 1:NP_001027087.1 Gene:bbx / 3772670 FlyBaseID:FBgn0024251 Length:769 Species:Drosophila melanogaster
Sequence 2:NP_037353.2 Gene:Hbp1 / 27080 RGDID:620444 Length:523 Species:Rattus norvegicus


Alignment Length:81 Identity:29/81 - (35%)
Similarity:45/81 - (55%) Gaps:9/81 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 TADNTRPEHHARRPMNAFLIFCKRHRGIVKERYKTLENRAITKILGDWWAALDEQEKHCFT---- 347
            |...|.| :..:||||||::|.|::|....:.|...:||||:.||||.|..:..:|:..:|    
  Rat   434 TVSATSP-NKCKRPMNAFMLFAKKYRVEYTQMYPGKDNRAISVILGDRWKKMKNEERRMYTLEAK 497

  Fly   348 DLAQQNKDAFFNANPN 363
            .||::.|    ..||:
  Rat   498 ALAEEQK----RLNPD 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bbxNP_001027087.1 SOX-TCF_HMG-box 296..367 CDD:238684 26/72 (36%)
Hbp1NP_037353.2 AXH 223..348 CDD:419838
SOX-TCF_HMG-box 442..513 CDD:238684 26/72 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2746
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.