DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33822 and LOC569982

DIOPT Version :9

Sequence 1:NP_001027314.1 Gene:His1:CG33822 / 3772665 FlyBaseID:FBgn0053822 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_017212658.1 Gene:LOC569982 / 569982 -ID:- Length:200 Species:Danio rerio


Alignment Length:233 Identity:91/233 - (39%)
Similarity:118/233 - (50%) Gaps:41/233 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGGSSLLAIK 72
            |:.:|.||.||    |..:||::    .|||||.     |...:::..::...|||.|.||.|:|
Zfish     4 TAPAPAAAAPA----KAPRKKSA----AKAKKAG-----PGVGELIVKAVSASKERSGMSLAALK 55

  Fly    73 KYITAT-YKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKAKSKVLSA 136
            |.:.|: |  |.:|....:|..:|..|..|.|.|.||.||||||||:   |::.:||.|      
Zfish    56 KALAASGY--DVEKNNSRVKLAIKGMVTKGVLKQVKGTGASGSFKLN---KQQAEPKKK------ 109

  Fly   137 EKKVQSKKVASKKIGVSSKKTAVGAADKKPK--AKKAVATKKTAENKKTEKAKAKDAKKTGIIKS 199
                .:||.|.|     :||.   ||.||||  |.|..|.||:.:..|...|.||.|.|:.....
Zfish   110 ----PAKKAAPK-----AKKP---AAAKKPKSAAAKKPAAKKSPKKAKKPAAAAKKATKSPKKAK 162

  Fly   200 KPAATKAKVTAAKPKAVVAKASKAKPAVSAKPKKTVKK 237
            ||||.| |...:..||.|||...|||. :|||||...|
Zfish   163 KPAAPK-KAAKSPKKAKVAKPKTAKPK-AAKPKKAAPK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33822NP_001027314.1 Linker_histone 46..118 CDD:278939 29/72 (40%)
LOC569982XP_017212658.1 Linker_histone 30..100 CDD:278939 29/71 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.