DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33822 and h1-10

DIOPT Version :9

Sequence 1:NP_001027314.1 Gene:His1:CG33822 / 3772665 FlyBaseID:FBgn0053822 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_954970.1 Gene:h1-10 / 322508 ZFINID:ZDB-GENE-030131-1228 Length:192 Species:Danio rerio


Alignment Length:241 Identity:84/241 - (34%)
Similarity:116/241 - (48%) Gaps:59/241 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGGSSLL 69
            ||...::|..| ||..|||.....|:..|..|.||:.....:   .::|..:|:.|.|:.||||.
Zfish     3 AVVEESAPAPA-PAPAEKKAKPAVAASPAKKKKKKSKGPGKY---SKLVTDAIRTLGEKNGSSLF 63

  Fly    70 AIKKYITATYKCDAQKLAPFIKK----YLKSA----VVNGKLIQTKGKGASGSFKLSASAKKEKD 126
            .|..        :|:|::.|.:|    ||:::    |:|..|:|.||.||:|||||: ..|.||.
Zfish    64 KIYN--------EAKKVSWFDQKNGRMYLRASIRALVLNDTLVQVKGFGANGSFKLN-KKKLEKK 119

  Fly   127 PKAKSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEKAKAKDA 191
            |               ||.||||   ::|||      :||.:||||..|.:|:         |.|
Zfish   120 P---------------KKAASKK---ATKKT------EKPTSKKAVTKKVSAK---------KSA 151

  Fly   192 KKTGIIKSKPAATKAKVTAAKPKAVVAKASKAKPAVSAKPKKTVKK 237
            ||:.:.|..|..|..|...||||    |.:..||..:|| |||..|
Zfish   152 KKSPVKKKTPKKTSVKKATAKPK----KTASKKPKAAAK-KKTKSK 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33822NP_001027314.1 Linker_histone 46..118 CDD:278939 27/79 (34%)
h1-10NP_954970.1 Linker_histone 43..109 CDD:366156 24/76 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.