DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33822 and H1-2

DIOPT Version :9

Sequence 1:NP_001027314.1 Gene:His1:CG33822 / 3772665 FlyBaseID:FBgn0053822 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_005310.1 Gene:H1-2 / 3006 HGNCID:4716 Length:213 Species:Homo sapiens


Alignment Length:249 Identity:104/249 - (41%)
Similarity:126/249 - (50%) Gaps:50/249 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGG 65
            ||::|   .|:|.|||||  ||..|:|||:..||...:|||.    ||..:::..::...|||.|
Human     1 MSETA---PAAPAAAPPA--EKAPVKKKAAKKAGGTPRKASG----PPVSELITKAVAASKERSG 56

  Fly    66 SSLLAIKKYITAT-YKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKA 129
            .||.|:||.:.|. |  |.:|....||..|||.|..|.|:||||.||||||||:   ||....:|
Human    57 VSLAALKKALAAAGY--DVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLN---KKAASGEA 116

  Fly   130 KSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEKAK------- 187
            |.||              ||.|.:..|..|||| ||||.....||.|.:..|..:|||       
Human   117 KPKV--------------KKAGGTKPKKPVGAA-KKPKKAAGGATPKKSAKKTPKKAKKPAAATV 166

  Fly   188 ----AKDAKKTGIIKSKPAATKAKVTAAKPKAVVAKASKAKPAVSAKPKKTVKK 237
                ||..||..:.|.|.|| |:...|.||||       |||.| .||||...|
Human   167 TKKVAKSPKKAKVAKPKKAA-KSAAKAVKPKA-------AKPKV-VKPKKAAPK 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33822NP_001027314.1 Linker_histone 46..118 CDD:278939 34/72 (47%)
H1-2NP_005310.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 23/48 (48%)
Linker_histone 38..108 CDD:366156 34/71 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..213 61/147 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10654
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4734
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2142
SonicParanoid 1 1.000 - - X117
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.990

Return to query results.
Submit another query.