DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7215 and Ubqln4

DIOPT Version :10

Sequence 1:NP_650680.1 Gene:CG7215 / 3772662 FlyBaseID:FBgn0038571 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_277068.1 Gene:Ubqln4 / 94232 MGIID:2150152 Length:596 Species:Mus musculus


Alignment Length:75 Identity:18/75 - (24%)
Similarity:39/75 - (52%) Gaps:2/75 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQITIKVLKGKDCTIEVAPTSTILEVKHQIEAELQISATNQKLLLLGRPLNNEQTIASYPNIKEG 65
            :::|:|..|.|: .|.:...:::.|.|.:|....:.......|:..|:.|.:..|::.: .||:|
Mouse    13 IRVTVKTPKDKE-EIVICDQASVKEFKEEISRRFKAQQDQLVLIFAGKILKDGDTLSQH-GIKDG 75

  Fly    66 TKLNLVVIKP 75
            ..::||:..|
Mouse    76 LTVHLVIKTP 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7215NP_650680.1 Ubl1_cv_Nsp3_N-like 1..72 CDD:475130 16/70 (23%)
Tugs 87..121 CDD:465528
Ubqln4NP_277068.1 Ubl_PLICs 11..83 CDD:340506 17/71 (24%)
rad23 13..>259 CDD:273167 18/75 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..148
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..361
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 482..528
UBA_PLICs 553..592 CDD:270582
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.