DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7215 and ZFAND4

DIOPT Version :9

Sequence 1:NP_001163644.1 Gene:CG7215 / 3772662 FlyBaseID:FBgn0038571 Length:130 Species:Drosophila melanogaster
Sequence 2:XP_016872420.1 Gene:ZFAND4 / 93550 HGNCID:23504 Length:741 Species:Homo sapiens


Alignment Length:137 Identity:32/137 - (23%)
Similarity:55/137 - (40%) Gaps:21/137 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQITIKVLKGKDCTIEVAPTSTILEVKHQIEAELQISATNQKLLLLGRPLNN------EQTIAS- 58
            |::.|:.|.|....:.|:|..|::.||.:|. .|:: .|:..|..:...|::      |:|..| 
Human    84 MELFIETLTGTCFELRVSPFETVISVKAKIR-RLEV-PTDDPLRKMAEYLDSSRVEVWEKTSCSK 146

  Fly    59 ---YPNIKEGTKLNLV--------VIKPCLRDSILRGFRKHYSEPLAE-RMTNEFMADFERKINE 111
               :...:||.:||..        .:.|....|....|..|......| ||:..|:.......|.
Human   147 QVTFLVYQEGDQLNFFPAVDRGDGTLTPLSDSSKKIDFHLHVLRRKGEHRMSYCFLCSGGSMYNS 211

  Fly   112 QSLDDLE 118
            .:.:|.|
Human   212 DTDEDEE 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7215NP_001163644.1 UBQ 1..72 CDD:214563 21/88 (24%)
ubiquitin 6..72 CDD:278661 19/83 (23%)
ZFAND4XP_016872420.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.