DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7215 and UBI4

DIOPT Version :9

Sequence 1:NP_001163644.1 Gene:CG7215 / 3772662 FlyBaseID:FBgn0038571 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_013061.1 Gene:UBI4 / 850620 SGDID:S000003962 Length:381 Species:Saccharomyces cerevisiae


Alignment Length:151 Identity:41/151 - (27%)
Similarity:74/151 - (49%) Gaps:30/151 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQITIKVLKGKDCTIEVAPTSTILEVKHQIEAELQISATNQKLLLLGRPLNNEQTIASYPNIKEG 65
            |||.:|.|.||..|:||..:.||..||.:|:.:..|....|:|:..|:.|.:.:|::.| ||::.
Yeast     1 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY-NIQKE 64

  Fly    66 TKLNLVVIKPCLRDSILRGFRKHYSEPLA------ERMTNEFMADFERKINE------------- 111
            :.|:||     ||   |||..:.:.:.|.      |..:::.:.:.:.||.:             
Yeast    65 STLHLV-----LR---LRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIF 121

  Fly   112 --QSLDDLERLADSIVNRAAT 130
              :.|:|...|:|..:.:.:|
Yeast   122 AGKQLEDGRTLSDYNIQKEST 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7215NP_001163644.1 UBQ 1..72 CDD:214563 26/70 (37%)
ubiquitin 6..72 CDD:278661 23/65 (35%)
UBI4NP_013061.1 Ubl_ubiquitin 1..76 CDD:340501 31/83 (37%)
Ubl_ubiquitin 77..152 CDD:340501 9/66 (14%)
Ubl_ubiquitin 153..228 CDD:340501
Ubl_ubiquitin 229..304 CDD:340501
Ubl_ubiquitin 305..380 CDD:340501
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.