DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7215 and RUB3

DIOPT Version :10

Sequence 1:NP_650680.1 Gene:CG7215 / 3772662 FlyBaseID:FBgn0038571 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_172662.1 Gene:RUB3 / 837750 AraportID:AT1G11980 Length:78 Species:Arabidopsis thaliana


Alignment Length:84 Identity:27/84 - (32%)
Similarity:45/84 - (53%) Gaps:9/84 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQITIKVLKGKDCTIEVAPTSTILEVKHQIEAELQISATNQKLLLLGRPLNNEQTIASYPNIKEG 65
            |:|.:|.|..|...||:..|.||..:|.:||.:..|...:|:::..|:.|.::.|...| |::.|
plant     1 MEIKVKTLTEKQIDIEIELTDTIERIKERIEEKEGIPPVHQRIVYTGKQLADDLTAKHY-NLERG 64

  Fly    66 TKLNLVVIKPCLRDSILRG 84
            :.|:||:        .|||
plant    65 SVLHLVL--------ALRG 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7215NP_650680.1 Ubl1_cv_Nsp3_N-like 1..72 CDD:475130 23/70 (33%)
Tugs 87..121 CDD:465528
RUB3NP_172662.1 Ubl_NEDD8 3..76 CDD:340504 26/82 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.